Anti CHMP4B pAb (ATL-HPA051751 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051751-25

• 

Protein Description: charged multivesicular body protein 4B
Gene Name: CHMP4B
Alternative Gene Name: C20orf178, dJ553F4.4, Shax1, SNF7-2, VPS32B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038467: 96%, ENSRNOG00000034071: 96%
Entrez Gene ID: 128866
Uniprot ID: Q9H444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSV
• Gene Sequence: EQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSV
• Gene ID - Mouse: ENSMUSG00000038467
• Gene ID - Rat: ENSRNOG00000034071
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.