Anti CHMP1B pAb (ATL-HPA062896 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA062896-25

• 

Product Description

Protein Description: charged multivesicular body protein 1B
Gene Name: CHMP1B
Alternative Gene Name: C18orf2, CHMP1.5, Vps46B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109901: 98%, ENSRNOG00000002323: 97%
Entrez Gene ID: 57132
Uniprot ID: Q7LBR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT
• Gene Sequence: TAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT
• Gene ID - Mouse: ENSMUSG00000109901
• Gene ID - Rat: ENSRNOG00000002323
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links