Protein Description: charged multivesicular body protein 1B
Gene Name: CHMP1B
Alternative Gene Name: C18orf2, CHMP1.5, Vps46B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109901: 98%, ENSRNOG00000002323: 97%
Entrez Gene ID: 57132
Uniprot ID: Q7LBR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHMP1B
Alternative Gene Name: C18orf2, CHMP1.5, Vps46B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109901: 98%, ENSRNOG00000002323: 97%
Entrez Gene ID: 57132
Uniprot ID: Q7LBR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTT |
Documents & Links for Anti CHMP1B pAb (ATL-HPA062896 w/enhanced validation) | |
Datasheet | Anti CHMP1B pAb (ATL-HPA062896 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CHMP1B pAb (ATL-HPA062896 w/enhanced validation) at Atlas |
Documents & Links for Anti CHMP1B pAb (ATL-HPA062896 w/enhanced validation) | |
Datasheet | Anti CHMP1B pAb (ATL-HPA062896 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CHMP1B pAb (ATL-HPA062896 w/enhanced validation) |