Protein Description: cysteine rich hydrophobic domain 2
Gene Name: CHIC2
Alternative Gene Name: BTL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029229: 100%, ENSRNOG00000002267: 100%
Entrez Gene ID: 26511
Uniprot ID: Q9UKJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHIC2
Alternative Gene Name: BTL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029229: 100%, ENSRNOG00000002267: 100%
Entrez Gene ID: 26511
Uniprot ID: Q9UKJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLS |
| Documents & Links for Anti CHIC2 pAb (ATL-HPA076603) | |
| Datasheet | Anti CHIC2 pAb (ATL-HPA076603) Datasheet (External Link) |
| Vendor Page | Anti CHIC2 pAb (ATL-HPA076603) at Atlas |
| Documents & Links for Anti CHIC2 pAb (ATL-HPA076603) | |
| Datasheet | Anti CHIC2 pAb (ATL-HPA076603) Datasheet (External Link) |
| Vendor Page | Anti CHIC2 pAb (ATL-HPA076603) |