Anti CHIA pAb (ATL-HPA059193)

Atlas Antibodies

SKU:
ATL-HPA059193-25
  • Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chitinase, acidic
Gene Name: CHIA
Alternative Gene Name: AMCase, CHIT2, TSA1902
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062778: 82%, ENSRNOG00000033162: 85%
Entrez Gene ID: 27159
Uniprot ID: Q9BZP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYE
Gene Sequence DTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYE
Gene ID - Mouse ENSMUSG00000062778
Gene ID - Rat ENSRNOG00000033162
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHIA pAb (ATL-HPA059193)
Datasheet Anti CHIA pAb (ATL-HPA059193) Datasheet (External Link)
Vendor Page Anti CHIA pAb (ATL-HPA059193) at Atlas Antibodies

Documents & Links for Anti CHIA pAb (ATL-HPA059193)
Datasheet Anti CHIA pAb (ATL-HPA059193) Datasheet (External Link)
Vendor Page Anti CHIA pAb (ATL-HPA059193)