Anti CHERP pAb (ATL-HPA050647)

Atlas Antibodies

SKU:
ATL-HPA050647-25
  • Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal and glial cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcium homeostasis endoplasmic reticulum protein
Gene Name: CHERP
Alternative Gene Name: DAN16, ERPROT213-21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052488: 100%, ENSRNOG00000012323: 100%
Entrez Gene ID: 10523
Uniprot ID: Q8IWX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPHINHDDPSLVPNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPS
Gene Sequence PPHINHDDPSLVPNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPS
Gene ID - Mouse ENSMUSG00000052488
Gene ID - Rat ENSRNOG00000012323
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CHERP pAb (ATL-HPA050647)
Datasheet Anti CHERP pAb (ATL-HPA050647) Datasheet (External Link)
Vendor Page Anti CHERP pAb (ATL-HPA050647) at Atlas Antibodies

Documents & Links for Anti CHERP pAb (ATL-HPA050647)
Datasheet Anti CHERP pAb (ATL-HPA050647) Datasheet (External Link)
Vendor Page Anti CHERP pAb (ATL-HPA050647)