Protein Description: chromodomain helicase DNA binding protein 3
Gene Name: CHD3
Alternative Gene Name: Mi-2a, Mi2-ALPHA, ZFH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018474: 82%, ENSRNOG00000009722: 81%
Entrez Gene ID: 1107
Uniprot ID: Q12873
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CHD3
Alternative Gene Name: Mi-2a, Mi2-ALPHA, ZFH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018474: 82%, ENSRNOG00000009722: 81%
Entrez Gene ID: 1107
Uniprot ID: Q12873
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PAPSEKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMETEADAPSPAPSLGERLEPRKIPLEDEVPGVPGEMEPEPGYRGDREKSATESTPGERGEEKPLDG |
| Documents & Links for Anti CHD3 pAb (ATL-HPA076524) | |
| Datasheet | Anti CHD3 pAb (ATL-HPA076524) Datasheet (External Link) |
| Vendor Page | Anti CHD3 pAb (ATL-HPA076524) at Atlas |
| Documents & Links for Anti CHD3 pAb (ATL-HPA076524) | |
| Datasheet | Anti CHD3 pAb (ATL-HPA076524) Datasheet (External Link) |
| Vendor Page | Anti CHD3 pAb (ATL-HPA076524) |