Anti CHAT pAb (ATL-HPA048547)

Atlas Antibodies

SKU: ATL-HPA048547-25

• 

Protein Description: choline O-acetyltransferase
Gene Name: CHAT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021919: 96%, ENSRNOG00000025012: 96%
Entrez Gene ID: 1103
Uniprot ID: P28329
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN
• Gene Sequence: GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN
• Gene ID - Mouse: ENSMUSG00000021919
• Gene ID - Rat: ENSRNOG00000025012
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CHAT pAb (ATL-HPA048547) – 2 Found

Haidar, Mansour; Asselbergh, Bob; Adriaenssens, Elias; De Winter, Vicky; Timmermans, Jean-Pierre; Auer-Grumbach, Michaela; Juneja, Manisha; Timmerman, Vincent. Neuropathy-causing mutations in HSPB1 impair autophagy by disturbing the formation of SQSTM1/p62 bodies. Autophagy. 2019;15(6):1051-1068. 

Hatton, Christopher; Reeve, Amy; Lax, Nichola Zoe; Blain, Alasdair; Ng, Yi Shiau; El-Agnaf, Omar; Attems, Johannes; Taylor, John-Paul; Turnbull, Doug; Erskine, Daniel. Complex I reductions in the nucleus basalis of Meynert in Lewy body dementia: the role of Lewy bodies. Acta Neuropathologica Communications. 2020;8(1):103.