Protein Description: complement factor properdin
Gene Name: CFP
Alternative Gene Name: PFC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001128: 75%, ENSRNOG00000025811: 75%
Entrez Gene ID: 5199
Uniprot ID: P27918
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CFP
Alternative Gene Name: PFC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001128: 75%, ENSRNOG00000025811: 75%
Entrez Gene ID: 5199
Uniprot ID: P27918
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCS |
| Documents & Links for Anti CFP pAb (ATL-HPA072644) | |
| Datasheet | Anti CFP pAb (ATL-HPA072644) Datasheet (External Link) |
| Vendor Page | Anti CFP pAb (ATL-HPA072644) at Atlas |
| Documents & Links for Anti CFP pAb (ATL-HPA072644) | |
| Datasheet | Anti CFP pAb (ATL-HPA072644) Datasheet (External Link) |
| Vendor Page | Anti CFP pAb (ATL-HPA072644) |