Anti CFHR2 pAb (ATL-HPA049813)

Atlas Antibodies

SKU: ATL-HPA049813-25

• 

Protein Description: complement factor H-related 2
Gene Name: CFHR2
Alternative Gene Name: CFHL2, FHR2, HFL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026365: 43%, ENSRNOG00000042369: 39%
Entrez Gene ID: 3080
Uniprot ID: P36980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE
• Gene Sequence: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE
• Gene ID - Mouse: ENSMUSG00000026365
• Gene ID - Rat: ENSRNOG00000042369
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.