Anti CFH pAb (ATL-HPA049176)

Atlas Antibodies

SKU:
ATL-HPA049176-25
  • Immunohistochemical staining of human small intestine shows strong plasma positivity.
  • Western blot analysis in human plasma.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: complement factor H
Gene Name: CFH
Alternative Gene Name: ARMD4, ARMS1, FHL1, HF, HF1, HF2, HUS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026365: 66%, ENSRNOG00000030715: 66%
Entrez Gene ID: 3075
Uniprot ID: P08603
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKA
Gene Sequence CNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKA
Gene ID - Mouse ENSMUSG00000026365
Gene ID - Rat ENSRNOG00000030715
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CFH pAb (ATL-HPA049176)
Datasheet Anti CFH pAb (ATL-HPA049176) Datasheet (External Link)
Vendor Page Anti CFH pAb (ATL-HPA049176) at Atlas Antibodies

Documents & Links for Anti CFH pAb (ATL-HPA049176)
Datasheet Anti CFH pAb (ATL-HPA049176) Datasheet (External Link)
Vendor Page Anti CFH pAb (ATL-HPA049176)



Citations for Anti CFH pAb (ATL-HPA049176) – 2 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed
Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517.  PubMed