Anti CFAP73 pAb (ATL-HPA048539 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048539-25

• 
• 

Protein Description: cilia and flagella associated protein 73
Gene Name: CFAP73
Alternative Gene Name: CCDC42B, MIA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094282: 46%, ENSRNOG00000056407: 45%
Entrez Gene ID: 387885
Uniprot ID: A6NFT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRLALQEKLSTKLPEQAEDHVPPVLRLLEKRQELVDADQALQAQKEVFRTKTAALKQRWEQLEQKERELKGSFI
• Gene Sequence: FRLALQEKLSTKLPEQAEDHVPPVLRLLEKRQELVDADQALQAQKEVFRTKTAALKQRWEQLEQKERELKGSFI
• Gene ID - Mouse: ENSMUSG00000094282
• Gene ID - Rat: ENSRNOG00000056407
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.