Anti CFAP65 pAb (ATL-HPA055156)

Atlas Antibodies

SKU:
ATL-HPA055156-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated protein 65
Gene Name: CFAP65
Alternative Gene Name: CCDC108, DKFZp434O0527, MGC35338
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047021: 81%, ENSRNOG00000056996: 80%
Entrez Gene ID: 255101
Uniprot ID: Q6ZU64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVDVPIHILGWNSALIHFQGVGYNPHMMGDTAPFHNISSWDNSSIHSRLVVPGQNVFLSQSHISLGNIPVQSKCSRLLFLNNISKNEEIAFSWQPS
Gene Sequence TVDVPIHILGWNSALIHFQGVGYNPHMMGDTAPFHNISSWDNSSIHSRLVVPGQNVFLSQSHISLGNIPVQSKCSRLLFLNNISKNEEIAFSWQPS
Gene ID - Mouse ENSMUSG00000047021
Gene ID - Rat ENSRNOG00000056996
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CFAP65 pAb (ATL-HPA055156)
Datasheet Anti CFAP65 pAb (ATL-HPA055156) Datasheet (External Link)
Vendor Page Anti CFAP65 pAb (ATL-HPA055156) at Atlas Antibodies

Documents & Links for Anti CFAP65 pAb (ATL-HPA055156)
Datasheet Anti CFAP65 pAb (ATL-HPA055156) Datasheet (External Link)
Vendor Page Anti CFAP65 pAb (ATL-HPA055156)