Anti CFAP47 pAb (ATL-HPA054859)

Atlas Antibodies

SKU:
ATL-HPA054859-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated protein 47
Gene Name: CFAP47
Alternative Gene Name: CHDC2, CXorf22, CXorf30, CXorf59, FLJ36601, MGC34831, RP13-11B7.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073077: 54%, ENSRNOG00000008990: 26%
Entrez Gene ID: 286464
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APPPKSPPVVIQCQSRKRAEEKVEIILNAGFFGFSLTPDLTEVLVIPKRNSHNFCEDPNEIPKIHEFEYEIQFESEAMKSKLESCVALY
Gene Sequence APPPKSPPVVIQCQSRKRAEEKVEIILNAGFFGFSLTPDLTEVLVIPKRNSHNFCEDPNEIPKIHEFEYEIQFESEAMKSKLESCVALY
Gene ID - Mouse ENSMUSG00000073077
Gene ID - Rat ENSRNOG00000008990
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CFAP47 pAb (ATL-HPA054859)
Datasheet Anti CFAP47 pAb (ATL-HPA054859) Datasheet (External Link)
Vendor Page Anti CFAP47 pAb (ATL-HPA054859) at Atlas Antibodies

Documents & Links for Anti CFAP47 pAb (ATL-HPA054859)
Datasheet Anti CFAP47 pAb (ATL-HPA054859) Datasheet (External Link)
Vendor Page Anti CFAP47 pAb (ATL-HPA054859)