Protein Description: cilia and flagella associated protein 44
Gene Name: CFAP44
Alternative Gene Name: FLJ11142, WDR52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071550: 76%, ENSRNOG00000028077: 73%
Entrez Gene ID: 55779
Uniprot ID: Q96MT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CFAP44
Alternative Gene Name: FLJ11142, WDR52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071550: 76%, ENSRNOG00000028077: 73%
Entrez Gene ID: 55779
Uniprot ID: Q96MT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HSFGYDCRKRANLQLLDDSIAIYIAGNQLIFLNLKTKEQIYLRSSSGEGIGVIGVHPHKTYFTVAEKGSFPDIIIYEYPSLRPYRVLRDGTEKG |
| Documents & Links for Anti CFAP44 pAb (ATL-HPA067258) | |
| Datasheet | Anti CFAP44 pAb (ATL-HPA067258) Datasheet (External Link) |
| Vendor Page | Anti CFAP44 pAb (ATL-HPA067258) at Atlas |
| Documents & Links for Anti CFAP44 pAb (ATL-HPA067258) | |
| Datasheet | Anti CFAP44 pAb (ATL-HPA067258) Datasheet (External Link) |
| Vendor Page | Anti CFAP44 pAb (ATL-HPA067258) |