Anti CFAP206 pAb (ATL-HPA044891)

Atlas Antibodies

SKU:
ATL-HPA044891-25
  • Immunohistochemical staining of human fallopian tube shows strong membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated protein 206
Gene Name: CFAP206
Alternative Gene Name: C6orf165, dJ382I10.1, FLJ25974
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028294: 81%, ENSRNOG00000009061: 79%
Entrez Gene ID: 154313
Uniprot ID: Q8IYR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELGTFLTLSKKDKERQLKELTMIVTGIRLFNRDCGKGGEGIDDLPAVLHVAIPATMQHIDYQLETARSQVYRYTAILEKAANDPLMRAELQPYMLKEALYNIRQYEVFLQIILSDIITGAQEVEMMTKQLGAHLE
Gene Sequence ELGTFLTLSKKDKERQLKELTMIVTGIRLFNRDCGKGGEGIDDLPAVLHVAIPATMQHIDYQLETARSQVYRYTAILEKAANDPLMRAELQPYMLKEALYNIRQYEVFLQIILSDIITGAQEVEMMTKQLGAHLE
Gene ID - Mouse ENSMUSG00000028294
Gene ID - Rat ENSRNOG00000009061
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CFAP206 pAb (ATL-HPA044891)
Datasheet Anti CFAP206 pAb (ATL-HPA044891) Datasheet (External Link)
Vendor Page Anti CFAP206 pAb (ATL-HPA044891) at Atlas Antibodies

Documents & Links for Anti CFAP206 pAb (ATL-HPA044891)
Datasheet Anti CFAP206 pAb (ATL-HPA044891) Datasheet (External Link)
Vendor Page Anti CFAP206 pAb (ATL-HPA044891)



Citations for Anti CFAP206 pAb (ATL-HPA044891) – 1 Found
van Dam, Teunis J P; Kennedy, Julie; van der Lee, Robin; de Vrieze, Erik; Wunderlich, Kirsten A; Rix, Suzanne; Dougherty, Gerard W; Lambacher, Nils J; Li, Chunmei; Jensen, Victor L; Leroux, Michel R; Hjeij, Rim; Horn, Nicola; Texier, Yves; Wissinger, Yasmin; van Reeuwijk, Jeroen; Wheway, Gabrielle; Knapp, Barbara; Scheel, Jan F; Franco, Brunella; Mans, Dorus A; van Wijk, Erwin; Képès, François; Slaats, Gisela G; Toedt, Grischa; Kremer, Hannie; Omran, Heymut; Szymanska, Katarzyna; Koutroumpas, Konstantinos; Ueffing, Marius; Nguyen, Thanh-Minh T; Letteboer, Stef J F; Oud, Machteld M; van Beersum, Sylvia E C; Schmidts, Miriam; Beales, Philip L; Lu, Qianhao; Giles, Rachel H; Szklarczyk, Radek; Russell, Robert B; Gibson, Toby J; Johnson, Colin A; Blacque, Oliver E; Wolfrum, Uwe; Boldt, Karsten; Roepman, Ronald; Hernandez-Hernandez, Victor; Huynen, Martijn A. CiliaCarta: An integrated and validated compendium of ciliary genes. Plos One. 14(5):e0216705.  PubMed