Anti CFAP100 pAb (ATL-HPA046354 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046354-25
  • Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-CFAP100 antibody. Corresponding CFAP100 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cilia and flagella associated protein 100
Gene Name: CFAP100
Alternative Gene Name: CCDC37, FLJ40083, MIA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048794: 62%, ENSRNOG00000017959: 67%
Entrez Gene ID: 348807
Uniprot ID: Q494V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSANPFHLSGDVDFFLLRDQERNKALSERQQQKTMRVHQKMTYSSKVSAKHTSLRRQLQLEDKQEDLEARAEAEHQRAFRDYTTWKL
Gene Sequence PSANPFHLSGDVDFFLLRDQERNKALSERQQQKTMRVHQKMTYSSKVSAKHTSLRRQLQLEDKQEDLEARAEAEHQRAFRDYTTWKL
Gene ID - Mouse ENSMUSG00000048794
Gene ID - Rat ENSRNOG00000017959
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CFAP100 pAb (ATL-HPA046354 w/enhanced validation)
Datasheet Anti CFAP100 pAb (ATL-HPA046354 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CFAP100 pAb (ATL-HPA046354 w/enhanced validation)