Anti CES1 pAb (ATL-HPA046717 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046717-25
  • Immunohistochemistry analysis in human liver and cerebral cortex tissues using HPA046717 antibody. Corresponding CES1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: carboxylesterase 1
Gene Name: CES1
Alternative Gene Name: CEH, CES1A1, CES1A2, CES2, HMSE, HMSE1, SES1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061959: 73%, ENSRNOG00000015438: 73%
Entrez Gene ID: 1066
Uniprot ID: P23141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEHIEL
Gene Sequence HWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQTEHIEL
Gene ID - Mouse ENSMUSG00000061959
Gene ID - Rat ENSRNOG00000015438
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CES1 pAb (ATL-HPA046717 w/enhanced validation)
Datasheet Anti CES1 pAb (ATL-HPA046717 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CES1 pAb (ATL-HPA046717 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CES1 pAb (ATL-HPA046717 w/enhanced validation)
Datasheet Anti CES1 pAb (ATL-HPA046717 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CES1 pAb (ATL-HPA046717 w/enhanced validation)



Citations for Anti CES1 pAb (ATL-HPA046717 w/enhanced validation) – 1 Found
Yan, Victoria C; Muller, Florian L. Advantages of the Parent Nucleoside GS-441524 over Remdesivir for Covid-19 Treatment. Acs Medicinal Chemistry Letters. 2020;11(7):1361-1366.  PubMed
!