Protein Description: ceramide synthase 2
Gene Name: CERS2
Alternative Gene Name: FLJ10243, LASS2, SP260
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015714: 91%, ENSRNOG00000021138: 94%
Entrez Gene ID: 29956
Uniprot ID: Q96G23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CERS2
Alternative Gene Name: FLJ10243, LASS2, SP260
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015714: 91%, ENSRNOG00000021138: 94%
Entrez Gene ID: 29956
Uniprot ID: Q96G23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MAHKFITGKLVEDERSDREETESSEGEEAAAGGGAKSRPLANGHPILNNNHRKN |
| Documents & Links for Anti CERS2 pAb (ATL-HPA078737) | |
| Datasheet | Anti CERS2 pAb (ATL-HPA078737) Datasheet (External Link) |
| Vendor Page | Anti CERS2 pAb (ATL-HPA078737) at Atlas |
| Documents & Links for Anti CERS2 pAb (ATL-HPA078737) | |
| Datasheet | Anti CERS2 pAb (ATL-HPA078737) Datasheet (External Link) |
| Vendor Page | Anti CERS2 pAb (ATL-HPA078737) |