Anti CERS1 pAb (ATL-HPA045724 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045724-25

• 

Protein Description: ceramide synthase 1
Gene Name: CERS1
Alternative Gene Name: LAG1, LASS1, UOG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000087408: 81%, ENSRNOG00000062030: 76%
Entrez Gene ID: 10715
Uniprot ID: P27544
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
• Gene Sequence: VLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF
• Gene ID - Mouse: ENSMUSG00000087408
• Gene ID - Rat: ENSRNOG00000062030
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.