Anti CERCAM pAb (ATL-HPA051595)

Atlas Antibodies

SKU:
ATL-HPA051595-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus, nucleoli & cell junctions.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cerebral endothelial cell adhesion molecule
Gene Name: CERCAM
Alternative Gene Name: CEECAM1, CerCAM, GLT25D3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039787: 87%, ENSRNOG00000026604: 88%
Entrez Gene ID: 51148
Uniprot ID: Q5T4B2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDDD
Gene Sequence FDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDDD
Gene ID - Mouse ENSMUSG00000039787
Gene ID - Rat ENSRNOG00000026604
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CERCAM pAb (ATL-HPA051595)
Datasheet Anti CERCAM pAb (ATL-HPA051595) Datasheet (External Link)
Vendor Page Anti CERCAM pAb (ATL-HPA051595) at Atlas Antibodies

Documents & Links for Anti CERCAM pAb (ATL-HPA051595)
Datasheet Anti CERCAM pAb (ATL-HPA051595) Datasheet (External Link)
Vendor Page Anti CERCAM pAb (ATL-HPA051595)