Anti CEP95 pAb (ATL-HPA052426)

Atlas Antibodies

SKU:
ATL-HPA052426-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: centrosomal protein 95kDa
Gene Name: CEP95
Alternative Gene Name: CCDC45, DKFZp667E1824
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018372: 87%, ENSRNOG00000014354: 87%
Entrez Gene ID: 90799
Uniprot ID: Q96GE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALRRHDLLTTLVKKEYEHNKRLQDFKDCIRRQRLTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEMIFKKLFEEGLNIQKQRLRDLRNYAKEKRDEQRRRHQDELDSM
Gene Sequence ALRRHDLLTTLVKKEYEHNKRLQDFKDCIRRQRLTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEMIFKKLFEEGLNIQKQRLRDLRNYAKEKRDEQRRRHQDELDSM
Gene ID - Mouse ENSMUSG00000018372
Gene ID - Rat ENSRNOG00000014354
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CEP95 pAb (ATL-HPA052426)
Datasheet Anti CEP95 pAb (ATL-HPA052426) Datasheet (External Link)
Vendor Page Anti CEP95 pAb (ATL-HPA052426) at Atlas Antibodies

Documents & Links for Anti CEP95 pAb (ATL-HPA052426)
Datasheet Anti CEP95 pAb (ATL-HPA052426) Datasheet (External Link)
Vendor Page Anti CEP95 pAb (ATL-HPA052426)