Anti CENPT pAb (ATL-HPA058036)

Atlas Antibodies

SKU:
ATL-HPA058036-25
  • Immunohistochemical staining of human cerebral cortex shows moderate nucleolar positivity in neuronal cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nuclear bodies.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: centromere protein T
Gene Name: CENPT
Alternative Gene Name: C16orf56, CENP-T, FLJ13111
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013419: 31%, ENSRNOG00000019382: 34%
Entrez Gene ID: 80152
Uniprot ID: Q96BT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLHDGVEEAEKKMEEEGVSVSEMEATGAQGPSRVEEAEGHTEVTEAEGSQGTAEADGPGASSGDEDASGRAASPESASSTPESLQARRHHQFLEP
Gene Sequence PLHDGVEEAEKKMEEEGVSVSEMEATGAQGPSRVEEAEGHTEVTEAEGSQGTAEADGPGASSGDEDASGRAASPESASSTPESLQARRHHQFLEP
Gene ID - Mouse ENSMUSG00000013419
Gene ID - Rat ENSRNOG00000019382
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CENPT pAb (ATL-HPA058036)
Datasheet Anti CENPT pAb (ATL-HPA058036) Datasheet (External Link)
Vendor Page Anti CENPT pAb (ATL-HPA058036) at Atlas Antibodies

Documents & Links for Anti CENPT pAb (ATL-HPA058036)
Datasheet Anti CENPT pAb (ATL-HPA058036) Datasheet (External Link)
Vendor Page Anti CENPT pAb (ATL-HPA058036)