Anti CENPN pAb (ATL-HPA052870)

Atlas Antibodies

SKU: ATL-HPA052870-25

• 

Protein Description: centromere protein N
Gene Name: CENPN
Alternative Gene Name: BM039, C16orf60, FLJ13607, FLJ22660
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031756: 63%, ENSRNOG00000011296: 63%
Entrez Gene ID: 55839
Uniprot ID: Q96H22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWEV
• Gene Sequence: DETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWEV
• Gene ID - Mouse: ENSMUSG00000031756
• Gene ID - Rat: ENSRNOG00000011296
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.