Protein Description: cementum protein 1
Gene Name: CEMP1
Alternative Gene Name: CP-23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031789: 26%, ENSRNOG00000015493: 30%
Entrez Gene ID: 752014
Uniprot ID: Q6PRD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CEMP1
Alternative Gene Name: CP-23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031789: 26%, ENSRNOG00000015493: 30%
Entrez Gene ID: 752014
Uniprot ID: Q6PRD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPP |
| Documents & Links for Anti CEMP1 pAb (ATL-HPA075926) | |
| Datasheet | Anti CEMP1 pAb (ATL-HPA075926) Datasheet (External Link) |
| Vendor Page | Anti CEMP1 pAb (ATL-HPA075926) at Atlas |
| Documents & Links for Anti CEMP1 pAb (ATL-HPA075926) | |
| Datasheet | Anti CEMP1 pAb (ATL-HPA075926) Datasheet (External Link) |
| Vendor Page | Anti CEMP1 pAb (ATL-HPA075926) |