Anti CEMP1 pAb (ATL-HPA075926)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075926-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEMP1
Alternative Gene Name: CP-23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031789: 26%, ENSRNOG00000015493: 30%
Entrez Gene ID: 752014
Uniprot ID: Q6PRD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPP |
Gene Sequence | CPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPP |
Gene ID - Mouse | ENSMUSG00000031789 |
Gene ID - Rat | ENSRNOG00000015493 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEMP1 pAb (ATL-HPA075926) | |
Datasheet | Anti CEMP1 pAb (ATL-HPA075926) Datasheet (External Link) |
Vendor Page | Anti CEMP1 pAb (ATL-HPA075926) at Atlas Antibodies |
Documents & Links for Anti CEMP1 pAb (ATL-HPA075926) | |
Datasheet | Anti CEMP1 pAb (ATL-HPA075926) Datasheet (External Link) |
Vendor Page | Anti CEMP1 pAb (ATL-HPA075926) |