Anti CEMP1 pAb (ATL-HPA057658)
Atlas Antibodies
- SKU:
- ATL-HPA057658-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CEMP1
Alternative Gene Name: CP-23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111607: 24%, ENSRNOG00000010479: 25%
Entrez Gene ID: 752014
Uniprot ID: Q6PRD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRM |
Gene Sequence | NSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRM |
Gene ID - Mouse | ENSMUSG00000111607 |
Gene ID - Rat | ENSRNOG00000010479 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CEMP1 pAb (ATL-HPA057658) | |
Datasheet | Anti CEMP1 pAb (ATL-HPA057658) Datasheet (External Link) |
Vendor Page | Anti CEMP1 pAb (ATL-HPA057658) at Atlas Antibodies |
Documents & Links for Anti CEMP1 pAb (ATL-HPA057658) | |
Datasheet | Anti CEMP1 pAb (ATL-HPA057658) Datasheet (External Link) |
Vendor Page | Anti CEMP1 pAb (ATL-HPA057658) |