Anti CELSR1 pAb (ATL-HPA052976)

Atlas Antibodies

SKU:
ATL-HPA052976-25
  • Immunofluorescent staining of human cell line A549 shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cadherin, EGF LAG seven-pass G-type receptor 1
Gene Name: CELSR1
Alternative Gene Name: ADGRC1, CDHF9, FMI2, HFMI2, ME2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016028: 58%, ENSRNOG00000021285: 60%
Entrez Gene ID: 9620
Uniprot ID: Q9NYQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTSFRLQILNNYLQFEVSHGPSDVESVMLSGLRVTDGEWHHLLIELKNVKEDSEMKHLVTMTLDYGMDQNKADIGGMLPGLTVRSVVV
Gene Sequence PTSFRLQILNNYLQFEVSHGPSDVESVMLSGLRVTDGEWHHLLIELKNVKEDSEMKHLVTMTLDYGMDQNKADIGGMLPGLTVRSVVV
Gene ID - Mouse ENSMUSG00000016028
Gene ID - Rat ENSRNOG00000021285
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CELSR1 pAb (ATL-HPA052976)
Datasheet Anti CELSR1 pAb (ATL-HPA052976) Datasheet (External Link)
Vendor Page Anti CELSR1 pAb (ATL-HPA052976) at Atlas Antibodies

Documents & Links for Anti CELSR1 pAb (ATL-HPA052976)
Datasheet Anti CELSR1 pAb (ATL-HPA052976) Datasheet (External Link)
Vendor Page Anti CELSR1 pAb (ATL-HPA052976)