Anti CELF6 pAb (ATL-HPA053526)

Atlas Antibodies

SKU: ATL-HPA053526-25

• 
• 

Protein Description: CUGBP, Elav-like family member 6
Gene Name: CELF6
Alternative Gene Name: BRUNOL6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032297: 93%, ENSRNOG00000052224: 97%
Entrez Gene ID: 60677
Uniprot ID: Q96J87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRLGFSTADSGVGMSGLNPGPAVPMKDHDA
• Gene Sequence: PRLGFSTADSGVGMSGLNPGPAVPMKDHDA
• Gene ID - Mouse: ENSMUSG00000032297
• Gene ID - Rat: ENSRNOG00000052224
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.