Anti CEACAM16 pAb (ATL-HPA045075)

Atlas Antibodies

SKU:
ATL-HPA045075-25
  • Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: carcinoembryonic antigen-related cell adhesion molecule 16
Gene Name: CEACAM16
Alternative Gene Name: DFNA4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014686: 96%, ENSRNOG00000031391: 95%
Entrez Gene ID: 388551
Uniprot ID: Q2WEN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKT
Gene Sequence VPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKT
Gene ID - Mouse ENSMUSG00000014686
Gene ID - Rat ENSRNOG00000031391
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CEACAM16 pAb (ATL-HPA045075)
Datasheet Anti CEACAM16 pAb (ATL-HPA045075) Datasheet (External Link)
Vendor Page Anti CEACAM16 pAb (ATL-HPA045075) at Atlas Antibodies

Documents & Links for Anti CEACAM16 pAb (ATL-HPA045075)
Datasheet Anti CEACAM16 pAb (ATL-HPA045075) Datasheet (External Link)
Vendor Page Anti CEACAM16 pAb (ATL-HPA045075)