Anti CDX4 pAb (ATL-HPA056528)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056528-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CDX4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031326: 95%, ENSRNOG00000002974: 95%
Entrez Gene ID: 1046
Uniprot ID: O14627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE |
Gene Sequence | RAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE |
Gene ID - Mouse | ENSMUSG00000031326 |
Gene ID - Rat | ENSRNOG00000002974 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDX4 pAb (ATL-HPA056528) | |
Datasheet | Anti CDX4 pAb (ATL-HPA056528) Datasheet (External Link) |
Vendor Page | Anti CDX4 pAb (ATL-HPA056528) at Atlas Antibodies |
Documents & Links for Anti CDX4 pAb (ATL-HPA056528) | |
Datasheet | Anti CDX4 pAb (ATL-HPA056528) Datasheet (External Link) |
Vendor Page | Anti CDX4 pAb (ATL-HPA056528) |