Anti CDX2 pAb (ATL-HPA045669)
Atlas Antibodies
- SKU:
- ATL-HPA045669-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CDX2
Alternative Gene Name: CDX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029646: 100%, ENSRNOG00000032759: 100%
Entrez Gene ID: 1045
Uniprot ID: Q99626
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVA |
Gene Sequence | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVA |
Gene ID - Mouse | ENSMUSG00000029646 |
Gene ID - Rat | ENSRNOG00000032759 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDX2 pAb (ATL-HPA045669) | |
Datasheet | Anti CDX2 pAb (ATL-HPA045669) Datasheet (External Link) |
Vendor Page | Anti CDX2 pAb (ATL-HPA045669) at Atlas Antibodies |
Documents & Links for Anti CDX2 pAb (ATL-HPA045669) | |
Datasheet | Anti CDX2 pAb (ATL-HPA045669) Datasheet (External Link) |
Vendor Page | Anti CDX2 pAb (ATL-HPA045669) |