Anti CDSN pAb (ATL-HPA054184 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054184-25

• 

Protein Description: corneodesmosin
Gene Name: CDSN
Alternative Gene Name: D6S586E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039518: 66%, ENSRNOG00000058561: 35%
Entrez Gene ID: 1041
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQ
• Gene Sequence: SSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQ
• Gene ID - Mouse: ENSMUSG00000039518
• Gene ID - Rat: ENSRNOG00000058561
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDSN pAb (ATL-HPA054184 w/enhanced validation) – 1 Found

Kapitány, Anikó; Medgyesi, Barbara; Jenei, Adrienn; Somogyi, Orsolya; Szabó, Lilla; Gáspár, Krisztián; Méhes, Gábor; Hendrik, Zoltán; Dócs, Klaudia; Szücs, Péter; Dajnoki, Zsolt; Szegedi, Andrea. Regional Differences in the Permeability Barrier of the Skin-Implications in Acantholytic Skin Diseases. International Journal Of Molecular Sciences. 2021;22(19)