Anti CDKN2A pAb (ATL-HPA047838)

Atlas Antibodies

SKU:
ATL-HPA047838-25
  • Immunofluorescent staining of human cell line PC-3 shows localization to nucleoli.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase inhibitor 2A
Gene Name: CDKN2A
Alternative Gene Name: ARF, CDK4I, CDKN2, CMM2, INK4, INK4a, MLM, MTS1, p14, p14ARF, p16, p16INK4a, p19, p19Arf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044303: 44%, ENSRNOG00000059837: 43%
Entrez Gene ID: 1029
Uniprot ID: Q8N726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPS
Gene Sequence LVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPS
Gene ID - Mouse ENSMUSG00000044303
Gene ID - Rat ENSRNOG00000059837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDKN2A pAb (ATL-HPA047838)
Datasheet Anti CDKN2A pAb (ATL-HPA047838) Datasheet (External Link)
Vendor Page Anti CDKN2A pAb (ATL-HPA047838) at Atlas Antibodies

Documents & Links for Anti CDKN2A pAb (ATL-HPA047838)
Datasheet Anti CDKN2A pAb (ATL-HPA047838) Datasheet (External Link)
Vendor Page Anti CDKN2A pAb (ATL-HPA047838)