Protein Description: cyclin-dependent kinase-like 1 (CDC2-related kinase)
Gene Name: CDKL1
Alternative Gene Name: KKIALRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020990: 67%, ENSRNOG00000038720: 61%
Entrez Gene ID: 8814
Uniprot ID: Q00532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDKL1
Alternative Gene Name: KKIALRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020990: 67%, ENSRNOG00000038720: 61%
Entrez Gene ID: 8814
Uniprot ID: Q00532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNY |
| Documents & Links for Anti CDKL1 pAb (ATL-HPA065919) | |
| Datasheet | Anti CDKL1 pAb (ATL-HPA065919) Datasheet (External Link) |
| Vendor Page | Anti CDKL1 pAb (ATL-HPA065919) at Atlas |
| Documents & Links for Anti CDKL1 pAb (ATL-HPA065919) | |
| Datasheet | Anti CDKL1 pAb (ATL-HPA065919) Datasheet (External Link) |
| Vendor Page | Anti CDKL1 pAb (ATL-HPA065919) |