Anti CDK5RAP2 pAb (ATL-HPA046529)

Atlas Antibodies

SKU:
ATL-HPA046529-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CDK5 regulatory subunit associated protein 2
Gene Name: CDK5RAP2
Alternative Gene Name: C48, CEP215, FLJ10867, MCPH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039298: 66%, ENSRNOG00000005788: 66%
Entrez Gene ID: 55755
Uniprot ID: Q96SN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLHNQEQVIKHLTESTNQKDVLLQKFNEKDLEVIQQNCYLMAAEDLELRSEGLITEKCSSQQPPGSKTIFSKEKKQSSDYEELIQVLKKEQDIYTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLSYQNLRKTLEEQISEIRRR
Gene Sequence KLHNQEQVIKHLTESTNQKDVLLQKFNEKDLEVIQQNCYLMAAEDLELRSEGLITEKCSSQQPPGSKTIFSKEKKQSSDYEELIQVLKKEQDIYTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLSYQNLRKTLEEQISEIRRR
Gene ID - Mouse ENSMUSG00000039298
Gene ID - Rat ENSRNOG00000005788
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDK5RAP2 pAb (ATL-HPA046529)
Datasheet Anti CDK5RAP2 pAb (ATL-HPA046529) Datasheet (External Link)
Vendor Page Anti CDK5RAP2 pAb (ATL-HPA046529) at Atlas Antibodies

Documents & Links for Anti CDK5RAP2 pAb (ATL-HPA046529)
Datasheet Anti CDK5RAP2 pAb (ATL-HPA046529) Datasheet (External Link)
Vendor Page Anti CDK5RAP2 pAb (ATL-HPA046529)



Citations for Anti CDK5RAP2 pAb (ATL-HPA046529) – 1 Found
Mahen, Robert. Stable centrosomal roots disentangle to allow interphase centriole independence. Plos Biology. 2018;16(4):e2003998.  PubMed