Protein Description: cyclin-dependent kinase 10
Gene Name: CDK10
Alternative Gene Name: PISSLRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033862: 100%, ENSRNOG00000016088: 100%
Entrez Gene ID: 8558
Uniprot ID: Q15131
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDK10
Alternative Gene Name: PISSLRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033862: 100%, ENSRNOG00000016088: 100%
Entrez Gene ID: 8558
Uniprot ID: Q15131
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLL |
| Documents & Links for Anti CDK10 pAb (ATL-HPA067060) | |
| Datasheet | Anti CDK10 pAb (ATL-HPA067060) Datasheet (External Link) |
| Vendor Page | Anti CDK10 pAb (ATL-HPA067060) at Atlas |
| Documents & Links for Anti CDK10 pAb (ATL-HPA067060) | |
| Datasheet | Anti CDK10 pAb (ATL-HPA067060) Datasheet (External Link) |
| Vendor Page | Anti CDK10 pAb (ATL-HPA067060) |