Anti CDHR4 pAb (ATL-HPA076277 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA076277-25

• 

Protein Description: cadherin related family member 4
Gene Name: CDHR4
Alternative Gene Name: CDH29, VLLR9392
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032595: 80%, ENSRNOG00000031643: 27%
Entrez Gene ID: 389118
Uniprot ID: A6H8M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATLDYKLWFRSSSNPASLCLYDRVLEVNATLDCDTPGACFQHAASILVLDGGQPQMTTEVPVLVMVTPINEFSPACAPRTFRVQE
• Gene Sequence: ATLDYKLWFRSSSNPASLCLYDRVLEVNATLDCDTPGACFQHAASILVLDGGQPQMTTEVPVLVMVTPINEFSPACAPRTFRVQE
• Gene ID - Mouse: ENSMUSG00000032595
• Gene ID - Rat: ENSRNOG00000031643
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.