Protein Description: cadherin related family member 4
Gene Name: CDHR4
Alternative Gene Name: CDH29, VLLR9392
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032595: 80%, ENSRNOG00000031643: 27%
Entrez Gene ID: 389118
Uniprot ID: A6H8M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDHR4
Alternative Gene Name: CDH29, VLLR9392
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032595: 80%, ENSRNOG00000031643: 27%
Entrez Gene ID: 389118
Uniprot ID: A6H8M9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ATLDYKLWFRSSSNPASLCLYDRVLEVNATLDCDTPGACFQHAASILVLDGGQPQMTTEVPVLVMVTPINEFSPACAPRTFRVQE |
Documents & Links for Anti CDHR4 pAb (ATL-HPA076277 w/enhanced validation) | |
Datasheet | Anti CDHR4 pAb (ATL-HPA076277 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CDHR4 pAb (ATL-HPA076277 w/enhanced validation) at Atlas |
Documents & Links for Anti CDHR4 pAb (ATL-HPA076277 w/enhanced validation) | |
Datasheet | Anti CDHR4 pAb (ATL-HPA076277 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CDHR4 pAb (ATL-HPA076277 w/enhanced validation) |