Protein Description: cell division cycle associated 5
Gene Name: CDCA5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024791: 60%, ENSRNOG00000046635: 44%
Entrez Gene ID: 113130
Uniprot ID: Q96FF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CDCA5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024791: 60%, ENSRNOG00000046635: 44%
Entrez Gene ID: 113130
Uniprot ID: Q96FF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE |
Documents & Links for Anti CDCA5 pAb (ATL-HPA076007 w/enhanced validation) | |
Datasheet | Anti CDCA5 pAb (ATL-HPA076007 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CDCA5 pAb (ATL-HPA076007 w/enhanced validation) at Atlas |
Documents & Links for Anti CDCA5 pAb (ATL-HPA076007 w/enhanced validation) | |
Datasheet | Anti CDCA5 pAb (ATL-HPA076007 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CDCA5 pAb (ATL-HPA076007 w/enhanced validation) |