Anti CDC6 pAb (ATL-HPA050114)

Atlas Antibodies

SKU:
ATL-HPA050114-25
  • Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cell division cycle 6
Gene Name: CDC6
Alternative Gene Name: CDC18L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017499: 91%, ENSRNOG00000027787: 87%
Entrez Gene ID: 990
Uniprot ID: Q99741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPP
Gene Sequence CQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPP
Gene ID - Mouse ENSMUSG00000017499
Gene ID - Rat ENSRNOG00000027787
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDC6 pAb (ATL-HPA050114)
Datasheet Anti CDC6 pAb (ATL-HPA050114) Datasheet (External Link)
Vendor Page Anti CDC6 pAb (ATL-HPA050114) at Atlas Antibodies

Documents & Links for Anti CDC6 pAb (ATL-HPA050114)
Datasheet Anti CDC6 pAb (ATL-HPA050114) Datasheet (External Link)
Vendor Page Anti CDC6 pAb (ATL-HPA050114)



Citations for Anti CDC6 pAb (ATL-HPA050114) – 1 Found
Xie, Zucheng; Dang, Yiwu; Wu, Huayu; He, Rongquan; Ma, Jie; Peng, Zhigang; Rong, Minhua; Li, Zhekun; Yang, Jiapeng; Jiang, Yizhao; Chen, Gang; Yang, Lihua. Effect of CELSR3 on the Cell Cycle and Apoptosis of Hepatocellular Carcinoma Cells. Journal Of Cancer. 11(10):2830-2844.  PubMed