Anti CDC40 pAb (ATL-HPA046620)

Atlas Antibodies

SKU: ATL-HPA046620-25

• 

Protein Description: cell division cycle 40
Gene Name: CDC40
Alternative Gene Name: EHB3, FLJ10564, PRP17, PRPF17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038446: 100%, ENSRNOG00000000581: 73%
Entrez Gene ID: 51362
Uniprot ID: O60508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKT
• Gene Sequence: VQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKT
• Gene ID - Mouse: ENSMUSG00000038446
• Gene ID - Rat: ENSRNOG00000000581
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.