Anti CDC27 pAb (ATL-HPA052399)

Atlas Antibodies

SKU: ATL-HPA052399-25

• 

Protein Description: cell division cycle 27
Gene Name: CDC27
Alternative Gene Name: ANAPC3, APC3, D0S1430E, D17S978E, NUC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020687: 100%, ENSRNOG00000005904: 100%
Entrez Gene ID: 996
Uniprot ID: P30260
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKS
• Gene Sequence: AIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKS
• Gene ID - Mouse: ENSMUSG00000020687
• Gene ID - Rat: ENSRNOG00000005904
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.