Anti CDC20B pAb (ATL-HPA053900)

Atlas Antibodies

SKU:
ATL-HPA053900-25
  • Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cell division cycle 20B
Gene Name: CDC20B
Alternative Gene Name: FLJ37927
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078926: 56%, ENSRNOG00000056012: 29%
Entrez Gene ID: 166979
Uniprot ID: Q86Y33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EASGSVLKTPPEKETLTLGSRKEQLKTPSKGISETSNSALHFCKAPHAMDRDWKESVASKGQKCLKQLFVTQNVVQQANGKMQLCEQS
Gene Sequence EASGSVLKTPPEKETLTLGSRKEQLKTPSKGISETSNSALHFCKAPHAMDRDWKESVASKGQKCLKQLFVTQNVVQQANGKMQLCEQS
Gene ID - Mouse ENSMUSG00000078926
Gene ID - Rat ENSRNOG00000056012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDC20B pAb (ATL-HPA053900)
Datasheet Anti CDC20B pAb (ATL-HPA053900) Datasheet (External Link)
Vendor Page Anti CDC20B pAb (ATL-HPA053900) at Atlas Antibodies

Documents & Links for Anti CDC20B pAb (ATL-HPA053900)
Datasheet Anti CDC20B pAb (ATL-HPA053900) Datasheet (External Link)
Vendor Page Anti CDC20B pAb (ATL-HPA053900)