Anti CD69 pAb (ATL-HPA050525 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050525-25

• 

Protein Description: CD69 molecule
Gene Name: CD69
Alternative Gene Name: CLEC2C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030156: 58%, ENSRNOG00000056783: 55%
Entrez Gene ID: 969
Uniprot ID: Q07108
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE
• Gene Sequence: VGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSE
• Gene ID - Mouse: ENSMUSG00000030156
• Gene ID - Rat: ENSRNOG00000056783
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD69 pAb (ATL-HPA050525 w/enhanced validation) – 2 Found

Chang, Margaret H; Levescot, Anaïs; Nelson-Maney, Nathan; Blaustein, Rachel B; Winden, Kellen D; Morris, Allyn; Wactor, Alexandra; Balu, Spoorthi; Grieshaber-Bouyer, Ricardo; Wei, Kevin; Henderson, Lauren A; Iwakura, Yoichiro; Clark, Rachael A; Rao, Deepak A; Fuhlbrigge, Robert C; Nigrovic, Peter A. Arthritis flares mediated by tissue-resident memory T cells in the joint. Cell Reports. 2021;37(4):109902. 

Griss, Johannes; Bauer, Wolfgang; Wagner, Christine; Simon, Martin; Chen, Minyi; Grabmeier-Pfistershammer, Katharina; Maurer-Granofszky, Margarita; Roka, Florian; Penz, Thomas; Bock, Christoph; Zhang, Gao; Herlyn, Meenhard; Glatz, Katharina; Läubli, Heinz; Mertz, Kirsten D; Petzelbauer, Peter; Wiesner, Thomas; Hartl, Markus; Pickl, Winfried F; Somasundaram, Rajasekharan; Steinberger, Peter; Wagner, Stephan N. B cells sustain inflammation and predict response to immune checkpoint blockade in human melanoma. Nature Communications. 2019;10(1):4186.