Anti CD68 pAb (ATL-HPA048982 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048982-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: CD68
Alternative Gene Name: DKFZp686M18236, GP110, LAMP4, macrosialin, SCARD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018774: 76%, ENSRNOG00000037563: 76%
Entrez Gene ID: 968
Uniprot ID: P34810
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG |
Gene Sequence | SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG |
Gene ID - Mouse | ENSMUSG00000018774 |
Gene ID - Rat | ENSRNOG00000037563 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CD68 pAb (ATL-HPA048982 w/enhanced validation) | |
Datasheet | Anti CD68 pAb (ATL-HPA048982 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD68 pAb (ATL-HPA048982 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CD68 pAb (ATL-HPA048982 w/enhanced validation) | |
Datasheet | Anti CD68 pAb (ATL-HPA048982 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CD68 pAb (ATL-HPA048982 w/enhanced validation) |
Citations for Anti CD68 pAb (ATL-HPA048982 w/enhanced validation) – 12 Found |
Mustafa, Tomris; Li, Qun; Kelly, Lauren E; Gibbon, Anne; Ryan, Irwin; Roffey, Keisha; Simonds, Stephanie; Cowley, Michael A; Sleeman, Mark W. Food hypersensitivity-induced chronic gastrointestinal inflammation in a non-human primate model of diet-induced obesity. Plos One. 14(4):e0214621. PubMed |
Jiang, Xintong; Wang, Feilong; Wang, Yajuan; Gisterå, Anton; Roy, Joy; Paulsson-Berne, Gabrielle; Hedin, Ulf; Lerman, Amir; Hansson, Göran K; Herrmann, Joerg; Yan, Zhong-Qun. Inflammasome-Driven Interleukin-1α and Interleukin-1β Production in Atherosclerotic Plaques Relates to Hyperlipidemia and Plaque Complexity. Jacc. Basic To Translational Science. 2019;4(3):304-317. PubMed |
Li, Dapeng; Edwards, Robert J; Manne, Kartik; Martinez, David R; Schäfer, Alexandra; Alam, S Munir; Wiehe, Kevin; Lu, Xiaozhi; Parks, Robert; Sutherland, Laura L; Oguin, Thomas H 3rd; McDanal, Charlene; Perez, Lautaro G; Mansouri, Katayoun; Gobeil, Sophie M C; Janowska, Katarzyna; Stalls, Victoria; Kopp, Megan; Cai, Fangping; Lee, Esther; Foulger, Andrew; Hernandez, Giovanna E; Sanzone, Aja; Tilahun, Kedamawit; Jiang, Chuancang; Tse, Longping V; Bock, Kevin W; Minai, Mahnaz; Nagata, Bianca M; Cronin, Kenneth; Gee-Lai, Victoria; Deyton, Margaret; Barr, Maggie; Von Holle, Tarra; Macintyre, Andrew N; Stover, Erica; Feldman, Jared; Hauser, Blake M; Caradonna, Timothy M; Scobey, Trevor D; Rountree, Wes; Wang, Yunfei; Moody, M Anthony; Cain, Derek W; DeMarco, C Todd; Denny, Thomas N; Woods, Christopher W; Petzold, Elizabeth W; Schmidt, Aaron G; Teng, I-Ting; Zhou, Tongqing; Kwong, Peter D; Mascola, John R; Graham, Barney S; Moore, Ian N; Seder, Robert; Andersen, Hanne; Lewis, Mark G; Montefiori, David C; Sempowski, Gregory D; Baric, Ralph S; Acharya, Priyamvada; Haynes, Barton F; Saunders, Kevin O. In vitro and in vivo functions of SARS-CoV-2 infection-enhancing and neutralizing antibodies. Cell. 2021;184(16):4203-4219.e32. PubMed |
Al Shboul, Sofian; Curran, Olimpia E; Alfaro, Javier A; Lickiss, Fiona; Nita, Erisa; Kowalski, Jacek; Naji, Faris; Nenutil, Rudolf; Ball, Kathryn L; Krejcir, Radovan; Vojtesek, Borivoj; Hupp, Ted R; Brennan, Paul M. Kinomics platform using GBM tissue identifies BTK as being associated with higher patient survival. Life Science Alliance. 2021;4(12) PubMed |
Zhang, Po; Liu, Guohao; Hu, Jinyang; Chen, Sui; Wang, Baofeng; Peng, Peng; Yu, Xingjiang; Guo, Dongsheng. Tenascin-C can Serve as an Indicator for the Immunosuppressive Microenvironment of Diffuse Low-Grade Gliomas. Frontiers In Immunology. 13( 35371015):824586. PubMed |
Louveau, Antoine; Smirnov, Igor; Keyes, Timothy J; Eccles, Jacob D; Rouhani, Sherin J; Peske, J David; Derecki, Noel C; Castle, David; Mandell, James W; Lee, Kevin S; Harris, Tajie H; Kipnis, Jonathan. Structural and functional features of central nervous system lymphatic vessels. Nature. 2015;523(7560):337-41. PubMed |
Swystun, Laura L; Lai, Jesse D; Notley, Colleen; Georgescu, Ilinca; Paine, A Simonne; Mewburn, Jeff; Nesbitt, Kate; Schledzewski, Kai; Géraud, Cyrill; Kzhyshkowska, Julia; Goerdt, Sergij; Hopman, Wilma; Montgomery, Robert R; James, Paula D; Lillicrap, David. The endothelial cell receptor stabilin-2 regulates VWF-FVIII complex half-life and immunogenicity. The Journal Of Clinical Investigation. 2018;128(9):4057-4073. PubMed |
Liu, Jie; Wang, Wang; Wang, Lei; Qi, Xian-Mei; Sha, Yu-Hui; Yang, Ting. 3-Bromopyruvate alleviates the development of monocrotaline-induced rat pulmonary arterial hypertension by decreasing aerobic glycolysis, inducing apoptosis, and suppressing inflammation. Chinese Medical Journal. 2020;133(1):49-60. PubMed |
Al Dujaily, Esraa; Baena, Juvenal; Das, Madhumita; Sereno, Marco; Smith, Claire; Kamata, Tamihiro; Officer, Leah; Pritchard, Catrin; Le Quesne, John. Reduced Protumorigenic Tumor-Associated Macrophages With Statin Use in Premalignant Human Lung Adenocarcinoma. Jnci Cancer Spectrum. 2020;4(2):pkz101. PubMed |
Jensen, Simon M; Bechshøft, Cecilie J L; Heisterberg, Mette F; Schjerling, Peter; Andersen, Jesper L; Kjaer, Michael; Mackey, Abigail L. Macrophage Subpopulations and the Acute Inflammatory Response of Elderly Human Skeletal Muscle to Physiological Resistance Exercise. Frontiers In Physiology. 11( 32792975):811. PubMed |
Nutma, Erik; Gebro, Emeline; Marzin, Manuel C; van der Valk, Paul; Matthews, Paul M; Owen, David R; Amor, Sandra. Activated microglia do not increase 18 kDa translocator protein (TSPO) expression in the multiple sclerosis brain. Glia. 2021;69(10):2447-2458. PubMed |
Hu, Jinyang; Dong, Feng; He, You; Xia, Xianyou; Cheng, Fangling; Chen, Sui; Hou, Xiaoshuang; Zhang, Po; Liu, Guohao; Li, Ying; Gao, Qian; Dong, Minhai; Li, Ting; Li, Wei; Xiao, Qungen; Li, Xiaopeng; Yu, Xingjiang; Xi, Guifa; Guo, Dongsheng; Wu, Xudong; Wang, Baofeng. LRIG2 promotes glioblastoma progression by modulating innate antitumor immunity through macrophage infiltration and polarization. Journal For Immunotherapy Of Cancer. 2022;10(9) PubMed |