Anti CD5L pAb (ATL-HPA068384 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA068384-25

• 
• 

Protein Description: CD5 molecule-like
Gene Name: CD5L
Alternative Gene Name: API6, Spalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015854: 63%, ENSRNOG00000023068: 59%
Entrez Gene ID: 922
Uniprot ID: O43866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDC
• Gene Sequence: LGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDC
• Gene ID - Mouse: ENSMUSG00000015854
• Gene ID - Rat: ENSRNOG00000023068
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.