Protein Description: CD5 molecule-like
Gene Name: CD5L
Alternative Gene Name: API6, Spalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015854: 72%, ENSRNOG00000023068: 79%
Entrez Gene ID: 922
Uniprot ID: O43866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CD5L
Alternative Gene Name: API6, Spalpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015854: 72%, ENSRNOG00000023068: 79%
Entrez Gene ID: 922
Uniprot ID: O43866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SCSGREATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKE |
| Documents & Links for Anti CD5L pAb (ATL-HPA065686 w/enhanced validation) | |
| Datasheet | Anti CD5L pAb (ATL-HPA065686 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD5L pAb (ATL-HPA065686 w/enhanced validation) at Atlas |
| Documents & Links for Anti CD5L pAb (ATL-HPA065686 w/enhanced validation) | |
| Datasheet | Anti CD5L pAb (ATL-HPA065686 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CD5L pAb (ATL-HPA065686 w/enhanced validation) |