Protein Description: CD48 molecule
Gene Name: CD48
Alternative Gene Name: BCM1, BLAST, hCD48, mCD48, SLAMF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015355: 54%, ENSRNOG00000004737: 48%
Entrez Gene ID: 962
Uniprot ID: P09326
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CD48
Alternative Gene Name: BCM1, BLAST, hCD48, mCD48, SLAMF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015355: 54%, ENSRNOG00000004737: 48%
Entrez Gene ID: 962
Uniprot ID: P09326
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESV |
| Documents & Links for Anti CD48 pAb (ATL-HPA055146) | |
| Datasheet | Anti CD48 pAb (ATL-HPA055146) Datasheet (External Link) |
| Vendor Page | Anti CD48 pAb (ATL-HPA055146) at Atlas |
| Documents & Links for Anti CD48 pAb (ATL-HPA055146) | |
| Datasheet | Anti CD48 pAb (ATL-HPA055146) Datasheet (External Link) |
| Vendor Page | Anti CD48 pAb (ATL-HPA055146) |