Anti CD248 pAb (ATL-HPA051856 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051856-25

• 
• 

Protein Description: CD248 molecule, endosialin
Gene Name: CD248
Alternative Gene Name: CD164L1, TEM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056481: 67%, ENSRNOG00000052685: 67%
Entrez Gene ID: 57124
Uniprot ID: Q9HCU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREPQIPYPEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATH
• Gene Sequence: EEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREPQIPYPEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATH
• Gene ID - Mouse: ENSMUSG00000056481
• Gene ID - Rat: ENSRNOG00000052685
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CD248 pAb (ATL-HPA051856 w/enhanced validation) – 3 Found

Sun, Dong-Xiu; Liao, Guang-Jun; Liu, Ke-Gui; Jian, Han. Endosialin‑expressing bone sarcoma stem‑like cells are highly tumor‑initiating and invasive. Molecular Medicine Reports. 2015;12(4):5665-70. 

Kondo, Yumiko; Honoki, Kanya; Kishi, Shingo; Mori, Shiori; Fujiwara-Tani, Rina; Tsukamoto, Shinji; Fujii, Hiromasa; Kuniyasu, Hiroki; Tanaka, Yasuhito. Endosialin/CD248 may be a potential therapeutic target to prevent the invasion and metastasis in osteosarcoma. Oncology Letters. 2022;23(2):42. 

Akbar, Moeed; McLean, Michael; Garcia-Melchor, Emma; Crowe, Lindsay An; McMillan, Paul; Fazzi, Umberto G; Martin, David; Arthur, Angus; Reilly, James H; McInnes, Iain B; Millar, Neal L. Fibroblast activation and inflammation in frozen shoulder. Plos One. 14(4):e0215301.