Protein Description: CD226 molecule
Gene Name: CD226
Alternative Gene Name: DNAM-1, DNAM1, PTA1, TLiSA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034028: 54%, ENSRNOG00000038197: 49%
Entrez Gene ID: 10666
Uniprot ID: Q15762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CD226
Alternative Gene Name: DNAM-1, DNAM1, PTA1, TLiSA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034028: 54%, ENSRNOG00000038197: 49%
Entrez Gene ID: 10666
Uniprot ID: Q15762
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA |
| Documents & Links for Anti CD226 pAb (ATL-HPA050348) | |
| Datasheet | Anti CD226 pAb (ATL-HPA050348) Datasheet (External Link) |
| Vendor Page | Anti CD226 pAb (ATL-HPA050348) at Atlas |
| Documents & Links for Anti CD226 pAb (ATL-HPA050348) | |
| Datasheet | Anti CD226 pAb (ATL-HPA050348) Datasheet (External Link) |
| Vendor Page | Anti CD226 pAb (ATL-HPA050348) |