Anti CD163 pAb (ATL-HPA051974 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051974-25
  • Immunohistochemistry analysis in human spleen and skeletal muscle tissues using HPA051974 antibody. Corresponding CD163 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: CD163 molecule
Gene Name: CD163
Alternative Gene Name: M130, MM130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008845: 75%, ENSRNOG00000010253: 83%
Entrez Gene ID: 9332
Uniprot ID: Q86VB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSD
Gene Sequence ACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSD
Gene ID - Mouse ENSMUSG00000008845
Gene ID - Rat ENSRNOG00000010253
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CD163 pAb (ATL-HPA051974 w/enhanced validation)
Datasheet Anti CD163 pAb (ATL-HPA051974 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD163 pAb (ATL-HPA051974 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CD163 pAb (ATL-HPA051974 w/enhanced validation)
Datasheet Anti CD163 pAb (ATL-HPA051974 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CD163 pAb (ATL-HPA051974 w/enhanced validation)



Citations for Anti CD163 pAb (ATL-HPA051974 w/enhanced validation) – 1 Found
Roy, Ananya; Attarha, Sanaz; Weishaupt, Holger; Edqvist, Per-Henrik; Swartling, Fredrik J; Bergqvist, Michael; Siebzehnrubl, Florian A; Smits, Anja; Pontén, Fredrik; Tchougounova, Elena. Serglycin as a potential biomarker for glioma: association of serglycin expression, extent of mast cell recruitment and glioblastoma progression. Oncotarget. 2017;8(15):24815-24827.  PubMed