Anti CCZ1 pAb (ATL-HPA050006)

Atlas Antibodies

SKU:
ATL-HPA050006-25
  • Immunohistochemical staining of human cervix shows strong granular cytoplasmic positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to vesicles.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CCZ1 homolog, vacuolar protein trafficking and biogenesis associated
Gene Name: CCZ1
Alternative Gene Name: C7orf28A, CCZ1A, CGI-43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029617: 97%, ENSRNOG00000001032: 97%
Entrez Gene ID: 51622
Uniprot ID: P86791
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLSFFIYNPRFGPREGQEENKILFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKPVIEY
Gene Sequence LLSFFIYNPRFGPREGQEENKILFYHPNEVEKNEKIRNVGLCEAIVQFTRTFSPSKPAKSLHTQKNRQFFNEPEENFWMVMVVRNPIIEKQSKDGKPVIEY
Gene ID - Mouse ENSMUSG00000029617
Gene ID - Rat ENSRNOG00000001032
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CCZ1 pAb (ATL-HPA050006)
Datasheet Anti CCZ1 pAb (ATL-HPA050006) Datasheet (External Link)
Vendor Page Anti CCZ1 pAb (ATL-HPA050006) at Atlas Antibodies

Documents & Links for Anti CCZ1 pAb (ATL-HPA050006)
Datasheet Anti CCZ1 pAb (ATL-HPA050006) Datasheet (External Link)
Vendor Page Anti CCZ1 pAb (ATL-HPA050006)